PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG091900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 287aa    MW: 32299.3 Da    PI: 9.5973
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG091900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.51.3e-3162112151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Pavir.3KG091900.2.p  62 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 112
                          79***********************************************95 PP

2K-box97.22.4e-321302274100
                K-box   4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                          ss    ++e + ++++qe+++L+++i nLq+++R l+G+++ ++s+k+L+qLe +L+k+l kiR++Kne+l +++e++q++e elq++n 
  Pavir.3KG091900.2.p 130 SSAAGtVAEVTIQHYKQESDRLRQQITNLQNSNRTLVGDSIATMSHKDLKQLEARLDKGLVKIRARKNEVLSSELEYMQRREMELQNDNL 219
                          44444689999******************************************************************************* PP

                K-box  93 aLrkklee 100
                          +Lr+++ee
  Pavir.3KG091900.2.p 220 YLRSRVEE 227
                          ****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.22154114IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-4054113IPR002100Transcription factor, MADS-box
CDDcd002652.99E-4555128No hitNo description
SuperFamilySSF554553.53E-3355127IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-335676IPR002100Transcription factor, MADS-box
PROSITE patternPS00350056110IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2663110IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-337691IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-3391112IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.267141231IPR002487Transcription factor, K-box
PfamPF014863.2E-24141225IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MHIQEVQATP STDIMWGFSG QTTLTSTTGL KLKEPAVSSP GSGSVGAAAA AEKNGRGKIE  60
IKRIENTTNR QVTFCKRRNG LLKKAYELSV LCDAEVALIV FSSRGRLYEY SNNSVKATIE  120
RYKKATSDNS SAAGTVAEVT IQHYKQESDR LRQQITNLQN SNRTLVGDSI ATMSHKDLKQ  180
LEARLDKGLV KIRARKNEVL SSELEYMQRR EMELQNDNLY LRSRVEENER AQQTVNMMGA  240
PSTSEDQQGF IPYDPIRSFL QFNIMQQQPQ FYSQQEDRKD FNLGGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-2055135282Myocyte-specific enhancer factor 2B
1tqe_R2e-2055135282Myocyte-specific enhancer factor 2B
1tqe_Q2e-2055135282Myocyte-specific enhancer factor 2B
1tqe_P2e-2055135282Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.420350.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankMZEZAG1A0.0L18924.1 Corn ZAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960599.10.0PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-127MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLQ418761e-160Q41876_MAIZE; Uncharacterized protein
STRINGSb09g006360.11e-163(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-94MIKC_MADS family protein